PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004286.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 169aa    MW: 19144.5 Da    PI: 4.8229
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004286.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.42.3e-5428124197
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              ++eqdr+lPianv+rimkk+lP nakisk+ak t+qecvsefisfvt+easdkcq+ekrkt+ngdd++wal++lGf+dy++plk y
  Itr_sc004286.1_g00004.1  28 MKEQDRLLPIANVGRIMKKILPPNAKISKEAKLTMQECVSEFISFVTGEASDKCQKEKRKTVNGDDVCWALGSLGFDDYAAPLKRY 113
                              589*********************************************************************************** PP

                    NF-YB  87 lkkyrelegek 97 
                              l++yre+ege+
  Itr_sc004286.1_g00004.1 114 LHRYREMEGER 124
                              *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5324146IPR009072Histone-fold
SuperFamilySSF471135.59E-4131149IPR009072Histone-fold
PfamPF008089.0E-273498IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.3E-176280No hitNo description
PROSITE patternPS0068506581IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.3E-178199No hitNo description
PRINTSPR006152.3E-17100118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MVDNIMQGFE YRSTGAGCSG TDGEDRVMKE QDRLLPIANV GRIMKKILPP NAKISKEAKL  60
TMQECVSEFI SFVTGEASDK CQKEKRKTVN GDDVCWALGS LGFDDYAAPL KRYLHRYREM  120
EGERANQSKS VVPGERSTDE REEDEEGAPI QFLPYTFPNQ QFHQVINID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4428119192Transcription factor HapC (Eurofung)
4g92_B5e-4428119192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269452.17e-71PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822484e-60NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA5ALQ92e-70A5ALQ9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0104g01640.t011e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-61nuclear factor Y, subunit B5